LL-37 cap-18 5mg Peptide Vial
LL-37 cap-18 5mg Peptide Vial Italy is an antibacterial peptide used to treat bacterial infections. Research has shown it is a member of the catatonic family of antimicrobial peptides found in humans.
LL-37 is a pharmaceutical peptide used to treat bacterial infections. Although its mechanism of function is derived from the innate LL-37, it has the potential to fight against both Gram-negative and Gram-positive bacteria. Research has suggested that it is one of the best antibacterial medications.
LL-37 has the potential to fight against bacteria, viruses, and fungi. It can be used against Gram-positive and Gram-negative—a quality not expressed by many antibacterial peptides. Research has discovered it could also be used to fight yeast infections.
LL-37 cap-18 5mg Peptide Vial has also been shown to stop the viral function of the herpes simplex virus. Also, scientific investigations have uncovered it reduces viral replication in the vaccinia (smallpox) virus.
LL-37 also functions as a chemo-attractant for immune cells. Large amounts of innate LL-37 are found in infection sites because they attract the white blood cells to the infection sites.
Furthermore, LL-37 studies have demonstrated it could bind and neutralize lipopolysaccharides; this is beneficial because of LPS from the outermost membrane of Gram-negative bacteria.
LL-37 cap-18 5mg Peptide Vial Italy could bind and neutralize the LPS on top of the gram-negative bacteria, the bacteria will not be protected. In turn, this will lead to the elimination of the bacteria.
LL-37 is also helpful in wound healing. Higher levels of LL-37 cap-18 Peptide are usually found in a wound, which often reduces after wound closure; scientists believe this shows that it helps in wound healing.
Also, higher amounts of LL-37 are found on the reforming epithelium of the wound, which means it also helps form the epithelium back.
Benefits of LL-37 cap-18 5mg Peptide Vial Italy
Italy Research has revealed the following benefits:
- Ability to fight bacteria, viruses & fungi. Including yeast infections and herpes simplex virus.
- Antimicrobial Functions
- Acts as a chemo-attractant
- Binding and neutralizing LPS
- Re-epithelialization and wound closure
Amino Acid Sequence: [LL-37, 37 aa]
Molecular Formula: C205H340N60O53
References:
https://pubmed.ncbi.nlm.nih.gov/16493063/
https://journals.aai.org/jimmunol/article/176/5/3044/73223/An-Antimicrobial-Cathelicidin-Peptide-Human-CAP18
ALL PRODUCT INFORMATION AND ARTICLES ON THIS SITE ARE FOR EDUCATIONAL PURPOSES ONLY
DISCLAIMER: All products sold by PharmaGrade.Store are for research and laboratory use only. These products are not designed for use or consumption by humans or animals. They are not to be classified as a drug, food, cosmetic, or medicinal product and must not be mislabelled or used as such. By purchasing from our Website the buyer accepts and acknowledges the risks involved with handling of these products. All articles and product information provided on this Website are for informational and educational purposes only. Handling and use of these products should be restricted to suitably qualified professionals.
